Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates using YY1 Rabbit mAb (A19569) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of various lysates using YY1 Rabbit mAb (A19569) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Confocal imaging of HeLa cells using YY1 Rabbit mAb (A19569, dilution 1:50)(Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.
Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg YY1 antibody (A19569). Western blot was performed from the immunoprecipitate using YY1 antibody (A19569) at a dilution of 1:2000.
| Product name | YY1 Rabbit mAb |
|---|---|
| Catalog No. | A19569 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC0048 |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human YY1 (P25490). |
|---|---|
| Sequence | PGNKKWEQKQVQIKTLEGEFSVTMWSSDEKKDIDHETVVEEQIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPRTIACPH |
| Gene ID | |
| Swiss Prot | |
| Synonyms | DELTA; NF-E1; UCRBP; GADEVS; INO80S; YIN-YANG-1; YY1 |
| Calculated MW | 45kDa |
| Observed MW | 60kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunofluorescence Immunoprecipitation |
| Positive samples | Mouse liver, Mouse kidney, U-251MG, HeLa, Jurkat, Raji |
| Cellular location | Nucleus matrix. |
| Customer validation | WB(Homo sapiens, Saccharomyces cerevisiae) IP(Homo sapiens) ChIP(Homo sapiens) IF(Saccharomyces cerevisiae) IP(Saccharomyces cerevisiae) ChIP(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A19569? Please let us know so that we can cite the reference in this datasheet.
