제품 > 항체 > 다중클론항체(pAb)

YY1 Rabbit pAb (A12928)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using YY1 Rabbit pAb (A12928) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Chromatin Immunoprecipitation - YY1 Rabbit pAb (A12928)

Chromatin immunoprecipitation analysis of extracts of 293T cells, using YY1 antibody (A12928) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Review

Overview

Product name	YY1 Rabbit pAb
Catalog No.	A12928
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

YY1 is a ubiquitously distributed transcription factor belonging to the GLI-Kruppel class of zinc finger proteins. The protein is involved in repressing and activating a diverse number of promoters. YY1 may direct histone deacetylases and histone acetyltransferases to a promoter in order to activate or repress the promoter, thus implicating histone modification in the function of YY1.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 80-160 of human YY1 (NP_003394.1).
Sequence	HPPMIALQPLVTDDPTQVHHHQEVILVQTREEVVGGDDSDGLRAEDGFEDQILIPVPAPAGGDDDYIEQTLVTVAAAGKSG
Gene ID
Swiss Prot
Synonyms	DELTA; NF-E1; UCRBP; GADEVS; INO80S; YIN-YANG-1; YY1
Calculated MW	45kDa
Observed MW	65kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements. ChIP 5μg antibody for 10μg-15μg of Chromatin
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HeLa, Jurkat, Raji, U-251MG, Mouse spleen, Mouse kidney, Rat lung
Cellular location	Nucleus matrix.
Customer validation	(Human breast cancer) WB(Mus musculus)