제품 > 항체 > 단일클론항체(mAb)

Yipf6 Rabbit mAb (A25920)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Western blot analysis of lysates from Mouse placenta using Yipf6 Rabbit mAb (A25920) at 1:1000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Overview

Product name	Yipf6 Rabbit mAb
Catalog No.	A25920
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC64940

Background

Enables identical protein binding activity. Acts upstream of or within intestinal epithelial cell development. Located in COPII-coated ER to Golgi transport vesicle; cis-Golgi network; and trans-Golgi network. Orthologous to human YIPF6 (Yip1 domain family member 6).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-83 of mouse Yipf6 (NP_997516.1).
Sequence	MAEAEDSPGEQEAAASKPLFAGLSDVSISQDIPIEGEITIPSRARAQEHDSSTLNESIRRTIMRDLKAVGRKFMHVLYPRKSN
Gene ID
Swiss Prot
Synonyms	A430107J06Rik
Calculated MW	26kDa
Observed MW	50kDa

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Mouse placenta
Cellular location	Golgi apparatus membrane.