Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse, Rat
Western blot analysis of lysates from Rat brain using Yipf6 Rabbit pAb (A22875) at 1:400 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Enhanced Kit (RM00021).
Exposuretime:90s.
| Product name | Yipf6 Rabbit pAb |
|---|---|
| Catalog No. | A22875 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-83 of mouse Yipf6(NP_997516.1). |
|---|---|
| Sequence | MAEAEDSPGEQEAAASKPLFAGLSDVSISQDIPIEGEITIPSRARAQEHDSSTLNESIRRTIMRDLKAVGRKFMHVLYPRKSN |
| Gene ID | |
| Swiss Prot | |
| Synonyms | A430107J06Rik; Yipf6 |
| Calculated MW | 26kDa |
| Observed MW | 26kDa |
| Reactivity | Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
| Key application | Western blotting |
| Positive samples | Rat brain |
| Cellular location | Golgi apparatus, Endoplasmic reticulum, Vesicles |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
