제품 > 항체 > 다중클론항체(pAb)

ZDHHC5 Rabbit pAb (A18114)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of lysates from U-87MG cells, using ZDHHC5 Rabbit pAb (A18114) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Overview

Product name	ZDHHC5 Rabbit pAb
Catalog No.	A18114
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables palmitoyltransferase activity. Involved in positive regulation of pattern recognition receptor signaling pathway and positive regulation of protein localization to plasma membrane. Acts upstream of or within protein palmitoylation. Located in phagocytic vesicle and plasma membrane.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 130-230 of human ZDHHC5 (NP_056272.2).
Sequence	FDHHCPWVNNCIGRRNYRYFFLFLLSLTAHIMGVFGFGLLYVLYHIEELSGVRTAVTMAVMCVAGLFFIPVAGLTGFHVVLVARGRTTNEQVTGKFRGGVN
Gene ID
Swiss Prot
Synonyms	DHHC5; ZNF375; ZDHHC5
Calculated MW	78kDa
Observed MW	78kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	U-87MG
Cellular location	dendrite, GABA-ergic synapse, glutamatergic synapse, plasma membrane
Customer validation	WB(Homo sapiens)