제품 > 항체 > 단일클론항체(mAb)

ZNF20 Rabbit PolymAb® (A25582PM)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse, Rat

Western blot analysis of lysates from wild type (WT) and 293T cells transfected with ZNF20 using ZNF20 Rabbit PolymAb® (A25582PM) at 1:10000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 20 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020)
.Exposure time: 10s.

ABclonal:Immunohistochemistry - ZNF20 Rabbit PolymAb® (A25582PM)

Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using ZNF20 Rabbit PolymAb® (A25582PM) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using ZNF20 Rabbit PolymAb® (A25582PM) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

ABclonal:Immunofluorescence - ZNF20 Rabbit PolymAb® (A25582PM)

Confocal imaging of paraffin-embedded Rat kidney tissue using ZNF20 Rabbit PolymAb® (A25582PM, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.

Overview

Product name	ZNF20 Rabbit PolymAb®
Catalog No.	A25582PM
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to enable DNA-binding transcription repressor activity, RNA polymerase II-specific and RNA polymerase II transcription regulatory region sequence-specific DNA binding activity. Predicted to be involved in negative regulation of transcription by RNA polymerase II. Predicted to be located in nucleus.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 51-118 of human ZNF20 (NP_066966.2).
Sequence	KVQNIEDEYKNPRRNLSLMREKLCESKESHHCGESFNQIADDMLNRKTLPGITPCESSVCGEVGTGHS
Gene ID
Swiss Prot
Synonyms	KOX13
Calculated MW	62kDa
Observed MW	62kDa

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:10000 - 1:60000 IHC-P 1:200 - 1:800 IF/ICC 1:200 - 1:800 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	293T transfected with ZNF20
Cellular location	Nucleus.