제품 > 항체 > 단일클론항체(mAb)

eEF1A1 Rabbit mAb (A11545)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using eEF1A1 Rabbit mAb (A11545) at 1：1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - eEF1A1 Rabbit mAb (A11545)

Confocal imaging of C6 cells using eEF1A1 Rabbit mAb (A11545, dilution 1:100)(Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 60x.

Overview

Product name	eEF1A1 Rabbit mAb
Catalog No.	A11545
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0626

Background

This gene encodes an isoform of the alpha subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This isoform (alpha 1) is expressed in brain, placenta, lung, liver, kidney, and pancreas, and the other isoform (alpha 2) is expressed in brain, heart and skeletal muscle. This isoform is identified as an autoantigen in 66% of patients with Felty syndrome. This gene has been found to have multiple copies on many chromosomes, some of which, if not all, represent different pseudogenes.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 250-350 of human eEF1A1 (NP_001393.1).
Sequence	LQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHP
Gene ID
Swiss Prot
Synonyms	CCS3; EF1A; PTI1; CCS-3; EE1A1; EEF-1; EEF1A; EF-Tu; EF1A1; LENG7; eEF1A-1; GRAF-1EF; EF1alpha1; eEF1A1
Calculated MW	50kDa
Observed MW	50kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	HeLa, 293T, MCF7, Mouse lung, Mouse liver, Mouse kidney, Rat kidney
Cellular location	Cytoplasm, Nucleus, nucleolus.
Customer validation	WB(Homo sapiens)