Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates using eIF2B epsilon (EIF2B5) (EIF2B5) Rabbit mAb (A8670) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
Immunohistochemistry analysis of eIF2B epsilon (EIF2B5) in paraffin-embedded human tonsil tissue using eIF2B epsilon (EIF2B5) Rabbit mAb (A8670) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of eIF2B epsilon (EIF2B5) in paraffin-embedded human breast tissue using eIF2B epsilon (EIF2B5) Rabbit mAb (A8670) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of eIF2B epsilon (EIF2B5) in paraffin-embedded human colon tissue using eIF2B epsilon (EIF2B5) Rabbit mAb (A8670) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of eIF2B epsilon (EIF2B5) in paraffin-embedded human breast cancer tissue using eIF2B epsilon (EIF2B5) Rabbit mAb (A8670) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Confocal imaging of MCF7 cells using eIF2B epsilon (EIF2B5) Rabbit mAb (A8670, dilution 1:100) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.
| Product name | eIF2B epsilon (EIF2B5) Rabbit mAb |
|---|---|
| Catalog No. | A8670 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC1774 |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human eIF2B epsilon (EIF2B5) (EIF2B5) (Q13144). |
|---|---|
| Sequence | MAAPVVAPPGVVVSRANKRSGAGPGGSGGGGARGAEEEPPPPLQAVLVADSFDRRFFPISKDQPRVLLPLANVALIDYTLEFLTATGVQETFVFCCWKAA |
| Gene ID | |
| Swiss Prot | |
| Synonyms | CLE; CACH; LVWM; EIF-2B; EIF2Bepsilon; eIF2B epsilon (EIF2B5) |
| Calculated MW | 80kDa |
| Observed MW | 80kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | HeLa, HT-29, U-87MG |
| Cellular location | Cytoplasm, Cytosol, eukaryotic translation initiation factor 2B complex, Nucleus |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
