제품 > 항체 > 다중클론항체(pAb)

eIF2B epsilon (EIF2B5) Rabbit pAb (A10263)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using eIF2B epsilon (EIF2B5) Rabbit pAb (A10263) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunofluorescence - eIF2B epsilon (EIF2B5) Rabbit pAb (A10263)

Immunofluorescence analysis of L929 cells using eIF2B epsilon (eIF2B epsilon (EIF2B5)) Rabbit pAb (A10263) at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - eIF2B epsilon (EIF2B5) Rabbit pAb (A10263)

Immunoprecipitation analysis of 200 μg extracts of A-549 cells using 3 μg eIF2B epsilon (eIF2B epsilon (EIF2B5)) antibody ( A10263). Western blot was performed from the immunoprecipitate using eIF2B epsilon (eIF2B epsilon (EIF2B5)) antibody ( A10263) at a dilution of 1:1000.

Overview

Product name	eIF2B epsilon (EIF2B5) Rabbit pAb
Catalog No.	A10263
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes one of five subunits of eukaryotic translation initiation factor 2B (EIF2B), a GTP exchange factor for eukaryotic initiation factor 2 and an essential regulator for protein synthesis. Mutations in this gene and the genes encoding other EIF2B subunits have been associated with leukoencephalopathy with vanishing white matter.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 442-721 of human eIF2B epsilon (eIF2B epsilon (EIF2B5)) (NP_003898.2).
Sequence	TLPEGSVISLHPPDAEEDEDDGEFSDDSGADQEKDKVKMKGYNPAEVGAAGKGYLWKAAGMNMEEEEELQQNLWGLKINMEEESESESEQSMDSEEPDSRGGSPQMDDIKVFQNEVLGTLQRGKEENISCDNLVLEINSLKYAYNISLKEVMQVLSHVVLEFPLQQMDSPLDSSRYCALLLPLLKAWSPVFRNYIKRAADHLEALAAIEDFFLEHEALGISMAKVLMAFYQLEILAEETILSWFSQRDTTDKGQQLRKNQQLQRFIQWLKEAEEESSEDD
Gene ID
Swiss Prot
Synonyms	CLE; CACH; LVWM; EIF-2B; EIF2Bepsilon; eIF2B epsilon (EIF2B5)
Calculated MW	80kDa
Observed MW	85kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	U-87MG, A-549, HL-60, HT-1080, LO2, Mouse brain
Cellular location	cytoplasm, cytosol, eukaryotic translation initiation factor 2B complex, nucleus.
Customer validation	WB(Homo sapiens, Mus musculus)