Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of extracts of various cell lines, using eIF3B Rabbit mAb (A9143) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunofluorescence analysis of C6 cells using eIF3B Rabbit mAb (A9143) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
| Product name | eIF3B Rabbit mAb |
|---|---|
| Catalog No. | A9143 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC1448 |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 101-200 of human eIF3B (NP_003742.2). |
|---|---|
| Sequence | VPAQGEAPGEQARDERSDSRAQAVSEDAGGNEGRAAEAEPRALENGDADEPSFSDPEDFVDDVSEEELLGDVLKDRPQEADGIDSVIVVDNVPQVGPDRL |
| Gene ID | |
| Swiss Prot | |
| Synonyms | PRT1; EIF3S9; EIF3-ETA; EIF3-P110; EIF3-P116 |
| Calculated MW | 93kDa |
| Observed MW | 116kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunofluorescence |
| Positive samples | HeLa, Jurkat |
| Cellular location | Cytoplasm |
| Customer validation | IF(Chlorocebus aethiops) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A9143? Please let us know so that we can cite the reference in this datasheet.
