제품 > 항체 > 다중클론항체(pAb)

eIF3B Rabbit pAb (A10259)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using eIF3B antibody (A10259) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunofluorescence - eIF3B Rabbit pAb (A10259)

Immunofluorescence analysis of HeLa cells using eIF3B Polyclonal Antibody (A10259) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of NIH-3T3 cells using eIF3B Polyclonal Antibody (A10259) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	eIF3B Rabbit pAb
Catalog No.	A10259
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables RNA binding activity. Contributes to translation initiation factor activity. Involved in several processes, including IRES-dependent viral translational initiation; translational initiation; and viral translational termination-reinitiation. Located in extracellular exosome. Part of eukaryotic translation initiation factor 3 complex.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 100-350 of human eIF3B (NP_003742.2).
Sequence	PVPAQGEAPGEQARDERSDSRAQAVSEDAGGNEGRAAEAEPRALENGDADEPSFSDPEDFVDDVSEEELLGDVLKDRPQEADGIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITNDFYPEEDGKTKGYIFLEYASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPFKDLGNLRYWLEEAECRDQYSVIFESGDRTSIFWNDVKDPVSIEERARWTETYVRWSPKGTYLA
Gene ID
Swiss Prot
Synonyms	PRT1; EIF3S9; EIF3-ETA; EIF3-P110; EIF3-P116
Calculated MW	93kDa
Observed MW	125kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HeLa, Jurkat, HT-1080, LO2, NIH/3T3, Rat thymus
Cellular location	Cytoplasm

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

eIF3B Rabbit pAb images

Western blot - eIF3B Rabbit pAb (A10259)

Immunofluorescence - eIF3B Rabbit pAb (A10259)

Immunofluorescence analysis of HeLa cells using eIF3B Polyclonal Antibody (A10259) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence - eIF3B Rabbit pAb (A10259)

Immunofluorescence analysis of NIH-3T3 cells using eIF3B Polyclonal Antibody (A10259) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

* For research use only. Not for therapeutic or diagnostic purposes.