제품 > 항체 > 다중클론항체(pAb)

hnRNP A1 Rabbit pAb (A7491)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using hnRNP A1 Rabbit pAb (A7491) at 1:200 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5min.

ABclonal:Immunohistochemistry - hnRNP A1 Rabbit pAb (A7491)

Immunohistochemistry analysis of paraffin-embedded Rat brain using hnRNP A1 Rabbit pAb (A7491) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Human breast cancer using hnRNP A1 Rabbit pAb (A7491) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Mouse kidney using hnRNP A1 Rabbit pAb (A7491) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - hnRNP A1 Rabbit pAb (A7491)

Immunofluorescence analysis of A549 cells using hnRNP A1 Rabbit pAb (A7491).Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution.

Overview

Product name	hnRNP A1 Rabbit pAb
Catalog No.	A7491
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a member of a family of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs), which are RNA-binding proteins that associate with pre-mRNAs in the nucleus and influence pre-mRNA processing, as well as other aspects of mRNA metabolism and transport. The protein encoded by this gene is one of the most abundant core proteins of hnRNP complexes and plays a key role in the regulation of alternative splicing. Mutations in this gene have been observed in individuals with amyotrophic lateral sclerosis 20. Multiple alternatively spliced transcript variants have been found. There are numerous pseudogenes of this gene distributed throughout the genome.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-372 of human hnRNP A1 (NP_112420.1).
Sequence	MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGGGSGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSGRRF
Gene ID
Swiss Prot
Synonyms	UP 1; ALS19; ALS20; HNRPA1; IBMPFD3; HNRPA1L3; hnRNP A1; hnRNP-A1
Calculated MW	39kDa
Observed MW	39kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	A-549, Jurkat, HepG2, HL-60, 293T
Cellular location	Cytoplasm, Nucleus
Customer validation	WB(Homo sapiens, Sus scrofa) IF(Sus scrofa)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

연구후성유전학 & 핵 신호전달RNA 결합

hnRNP A1 Rabbit pAb images

Western blot - hnRNP A1 Rabbit pAb (A7491)

Immunohistochemistry - hnRNP A1 Rabbit pAb (A7491)

Immunofluorescence - hnRNP A1 Rabbit pAb (A7491)

Immunofluorescence analysis of A549 cells using hnRNP A1 Rabbit pAb (A7491).Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution.

* For research use only. Not for therapeutic or diagnostic purposes.