제품 > 항체 > 단일클론항체(mAb)

p47phox/NCF1 Rabbit mAb (A5143)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of extracts of Raji cells, using p47phox/NCF1 Rabbit mAb (A5143) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Overview

Product name	p47phox/NCF1 Rabbit mAb
Catalog No.	A5143
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1206

Background

The protein encoded by this gene is a 47 kDa cytosolic subunit of neutrophil NADPH oxidase. This oxidase is a multicomponent enzyme that is activated to produce superoxide anion. Mutations in this gene have been associated with chronic granulomatous disease.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 291-390 of human p47phox/NCF1 (P14598).
Sequence	QRQIKRGAPPRRSSIRNAHSIHQRSRKRLSQDAYRRNSVRFLQQRRRQARPGPQSPGSPLEEERQTQRSKPQPAVPPRPSADLILNRCSESTKRKLASAV
Gene ID
Swiss Prot
Synonyms	CGD1; NCF1A; NOXO2; p47phox; SH3PXD1A
Calculated MW	45kDa
Observed MW	47kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Raji
Cellular location	Cytoplasm, Cytoplasmic side, Membrane, Peripheral membrane protein, Cytosol
Customer validation	WB(Mus musculus)