제품 > 항체 > 단일클론항체(mAb)

ABflo® 488 Conjugated GFAP Rabbit mAb (A26778)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Confocal imaging of paraffin-embedded Human brain tissue using ABflo® 488 Conjugated GFAP Rabbit mAb (A26778, dilution 1:500). DAPI was used for nuclear staining (Blue). Microwave antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IF staining. Objective: 40x.

Confocal imaging of paraffin-embedded Mouse brain tissue using ABflo® 488 Conjugated GFAP Rabbit mAb (A26778, dilution 1:200). DAPI was used for nuclear staining (Blue). Microwave antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IF staining. Objective: 40x.

Confocal imaging of paraffin-embedded Rat brain tissue using ABflo® 488 Conjugated GFAP Rabbit mAb (A26778, dilution 1:500). DAPI was used for nuclear staining (Blue). Microwave antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IF staining. Objective: 40x.

Overview

Product name	ABflo® 488 Conjugated GFAP Rabbit mAb
Catalog No.	A26778
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0206-ABf488

Background

This gene encodes one of the major intermediate filament proteins of mature astrocytes. It is used as a marker to distinguish astrocytes from other glial cells during development. Mutations in this gene cause Alexander disease, a rare disorder of astrocytes in the central nervous system. Alternative splicing results in multiple transcript variants encoding distinct isoforms.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GFAP (P14136).
Sequence	MERRRITSAARRSYVSSGEMMVGGLAPGRRLGPGTRLSLARMPPPLPTRVDFSLAGALNAGFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAE
Gene ID
Swiss Prot
Synonyms	ALXDRD
Calculated MW	50kDa
Observed MW	Refer to figures

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IF/ICC 1:200 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze. Buffer:PBS with 0.03% proclin300, 0.2% BSA, 50% glycerol, pH7.3.
Key application	Immunofluorescence
Positive samples
Cellular location	Cytoplasm.