Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | ABflo® 488 Conjugated GFAP Rabbit mAb |
---|---|
Catalog No. | A26778 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0206-ABf488 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GFAP (P14136). |
---|---|
Sequence | MERRRITSAARRSYVSSGEMMVGGLAPGRRLGPGTRLSLARMPPPLPTRVDFSLAGALNAGFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAE |
Gene ID | |
Swiss Prot | |
Synonyms | ALXDRD |
Calculated MW | 50kDa |
Observed MW | Refer to figures |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze. Buffer:PBS with 0.03% proclin300, 0.2% BSA, 50% glycerol, pH7.3. |
Key application | Immunofluorescence |
Positive samples | |
Cellular location | Cytoplasm. |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.