제품 > 항체 > 단일클론항체(mAb)

ABflo® 488 Rabbit anti-Human CD119/IFNGR1 mAb (A23816)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 HepG2 cells were surface-stained with ABflo® 488 Rabbit anti-Human CD119/IFNGR1 mAb(A23816, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line).Non-fluorescently stained HepG2 cells were used as blank control (red line).

Flow cytometry: 1X10^6 CHO cells(negative control) were surface-stained with ABflo® 488 Rabbit anti-Human CD119/IFNGR1 mAb(A23816, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line).Non-fluorescently stained CHO cells were used as blank control (red line).

Flow cytometry:1X10^6 HepG2 cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human CD119/IFNGR1 mAb(A23816, 5 μl/Test, right).

Flow cytometry: 1X10^6 Human PBMC were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human CD119/IFNGR1 mAb (A23816, 5 μl/Test, right).

Overview

Product name	ABflo® 488 Rabbit anti-Human CD119/IFNGR1 mAb
Catalog No.	A23816
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC59337-ABf488

Background

This gene (IFNGR1) encodes the ligand-binding chain (alpha) of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. A genetic variation in IFNGR1 is associated with susceptibility to Helicobacter pylori infection. In addition, defects in IFNGR1 are a cause of mendelian susceptibility to mycobacterial disease, also known as familial disseminated atypical mycobacterial infection.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 18-245 of human CD119/IFNGR1. (NP_000407.1).
Sequence	EMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFVNGDEQEVDYDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFNSSIKG
Gene ID
Swiss Prot
Synonyms	IFNGR1; CD119; IFNGR; IMD27A; IMD27B; interferon gamma receptor 1
Calculated MW	21kDa/54kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Membrane, Single-pass type I membrane protein.