제품 > 항체 > 단일클론항체(mAb)

IFNGR1 Rabbit mAb (A21912)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using IFNGR1 Rabbit mAb (A21912) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunofluorescence - IFNGR1 Rabbit mAb (A21912)

Immunofluorescence analysis of THP-1 cells using IFNGR1 Rabbit mAb (A21912) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	IFNGR1 Rabbit mAb
Catalog No.	A21912
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0662

Background

This gene (IFNGR1) encodes the ligand-binding chain (alpha) of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. A genetic variation in IFNGR1 is associated with susceptibility to Helicobacter pylori infection. In addition, defects in IFNGR1 are a cause of mendelian susceptibility to mycobacterial disease, also known as familial disseminated atypical mycobacterial infection.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 390-489 of human IFNGR1 (P15260).
Sequence	GSIALNSYHSRNCSESDHSRNGFDTDSSCLESHSSLSDSEFPPNNKGEIKTEGQELITVIKAPTSFGYDKPHVLVDLLVDDSGKESLIGYRPTEDSKEFS
Gene ID
Swiss Prot
Synonyms	CD119; IFNGR; IMD27A; IMD27B
Calculated MW	54kDa
Observed MW	40-100kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HeLa, 293T, BxPC-3, Mouse liver, Mouse spleen, Mouse thymus, Rat liver
Cellular location	Membrane, Single-pass type I membrane protein