제품 > 항체 > 단일클론항체(mAb)

ABflo® 488 Rabbit anti-Human CD34 mAb (A25855)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Confocal imaging of TF-1 cells using ABflo® 488 Rabbit anti-Human CD34 mAb (A25855, dilution 1:100) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

ABclonal:Flow CytoMetry - ABflo® 488 Rabbit anti-Human CD34 mAb (A25855)

Flow cytometry: 1X10^6 HeLa cells (negative control, left) and MOLT-4 cells (right) were surface-stained with ABflo® 488 Rabbit anti-Human CD34 mAb (A25855, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 MOLT-4 cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human CD34 mAb (A25855, 5 μl/Test, right).

Overview

Product name	ABflo® 488 Rabbit anti-Human CD34 mAb
Catalog No.	A25855
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC67795-ABflo488

Background

Enables sulfate binding activity. Acts upstream of or within leukocyte migration. Located in cytoplasm; external side of plasma membrane; and extracellular region. Is expressed in several structures, including alimentary system; cardiovascular system; extraembryonic component; genitourinary system; and skin. Orthologous to human CD34 (CD34 molecule).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 170-290 of human CD34 (NP_001020280.1).
Sequence	DIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKT
Gene ID
Swiss Prot
Synonyms	CD34; CD34 molecule; GIG3; MORT1
Calculated MW	35kDa/41kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IF/ICC 1:50 - 1:200 FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Immunofluorescence Flow Cytometry
Positive samples
Cellular location	Membrane, Single-pass type I membrane protein.

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ABflo® 488 Rabbit anti-Human CD34 mAb images

Immunofluorescence - ABflo® 488 Rabbit anti-Human CD34 mAb (A25855)

Confocal imaging of TF-1 cells using ABflo® 488 Rabbit anti-Human CD34 mAb (A25855, dilution 1:100) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Flow CytoMetry - ABflo® 488 Rabbit anti-Human CD34 mAb (A25855)

Flow cytometry: 1X10^6 MOLT-4 cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human CD34 mAb (A25855, 5 μl/Test, right).

* For research use only. Not for therapeutic or diagnostic purposes.