제품 > 항체 > 단일클론항체(mAb)

ABflo® 647 Rabbit anti-Human CD34 mAb (A25894)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Confocal imaging of TF-1 cells using ABflo® 647 Rabbit anti-Human CD34 mAb (A25894, dilution 1:100) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.

ABclonal:Flow CytoMetry - ABflo® 647 Rabbit anti-Human CD34 mAb (A25894)

Flow cytometry: 1X10^6 HeLa cells (negative control, left) and MOLT-4 cells (right) were surface-stained with ABflo® 647 Rabbit anti-Human CD34 mAb (A25894, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 MOLT-4 cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human CD34 mAb (A25894, 5 μl/Test, right).

Overview

Product name	ABflo® 647 Rabbit anti-Human CD34 mAb
Catalog No.	A25894
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC67795-ABflo647

Background

The protein encoded by this gene may play a role in the attachment of stem cells to the bone marrow extracellular matrix or to stromal cells. This single-pass membrane protein is highly glycosylated and phosphorylated by protein kinase C. Two transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 170-290 of human CD34 (NP_001020280.1).
Sequence	DIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKT
Gene ID
Swiss Prot
Synonyms	CD34; CD34 molecule; GIG3; MORT1
Calculated MW	35kDa/41kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IF/ICC 1:50 - 1:200 FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Immunofluorescence Flow Cytometry
Positive samples
Cellular location	Membrane, Single-pass type I membrane protein.

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ABflo® 647 Rabbit anti-Human CD34 mAb images

Immunofluorescence - ABflo® 647 Rabbit anti-Human CD34 mAb (A25894)

Confocal imaging of TF-1 cells using ABflo® 647 Rabbit anti-Human CD34 mAb (A25894, dilution 1:100) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.

Flow CytoMetry - ABflo® 647 Rabbit anti-Human CD34 mAb (A25894)

Flow cytometry: 1X10^6 MOLT-4 cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human CD34 mAb (A25894, 5 μl/Test, right).

* For research use only. Not for therapeutic or diagnostic purposes.