제품 > 항체 > 단일클론항체(mAb)

ABflo® 488 Rabbit anti-Human CD47 mAb (A24300)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry:1X10^6 HepG2 cells (Low Expression, Left) and MOLT-4 cells (Right) were surface-stained with ABflo® 488 Rabbit anti-Human CD47 mAb(A24300, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 MOLT-4 cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human CD47 mAb(A24300, 5 μl/Test, right).

Overview

Product name	ABflo® 488 Rabbit anti-Human CD47 mAb
Catalog No.	A24300
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC61212-ABflo488

Background

This gene encodes a membrane protein, which is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The encoded protein is also a receptor for the C-terminal cell binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This gene has broad tissue distribution, and is reduced in expression on Rh erythrocytes. Alternatively spliced transcript variants have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 19-139 of human CD47 (NP_001768.1).
Sequence	QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP
Gene ID
Swiss Prot
Synonyms	CD47; IAP; MER6; OA3; CD47 molecule
Calculated MW	31kDa/33kDa/35kDa
Observed MW	Refer to figures

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.03% proclin300, 0.2% BSA, 50% glycerol, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane, Multi-pass membrane protein

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ABflo® 488 Rabbit anti-Human CD47 mAb images

Flow CytoMetry - ABflo® 488 Rabbit anti-Human CD47 mAb (A24300)

Flow cytometry:1X10^6 MOLT-4 cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human CD47 mAb(A24300, 5 μl/Test, right).

* For research use only. Not for therapeutic or diagnostic purposes.