제품 > 항체 > 단일클론항체(mAb)

CD47 Rabbit mAb (A24296)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

1μg/mL of biotinylated CD47 protein was incubated with CD47 Rabbit mAb (A24296) or control mAb with serial dilution for 1 hour at RT. The mixture was added to ELISA plate coated with 1μg/mL of Recombinant Human SIRP-alpha/CD172a Protein (RP00171). HRP-Streptavidin was used for biotinylated CD47 detection.

ABclonal:Flow CytoMetry - CD47 Rabbit mAb (A24296)

Flow cytometry: 1X10^6 HepG2 cells (Low Expression, Left) and MOLT-4 cells(Right) were surface-stained with CD47 Rabbit mAb(A24296, 2μg/mL, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 2μg/mL, blue line), followed by Alexa Fluor®488 conjugated goat anti-rabbit pAb (1:200 dilution) staining. Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 MOLT-4 cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 2 μg/mL, left) or CD47 Rabbit mAb(A24296, 2 μg/mL, right).

Overview

Product name	CD47 Rabbit mAb
Catalog No.	A24296
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC61212

Background

This gene encodes a membrane protein, which is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The encoded protein is also a receptor for the C-terminal cell binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This gene has broad tissue distribution, and is reduced in expression on Rh erythrocytes. Alternatively spliced transcript variants have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 19-139 of human CD47 (NP_001768.1).
Sequence	QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP
Gene ID
Swiss Prot
Synonyms	IAP; OA3; MER6
Calculated MW	35kDa
Observed MW	Refer to figures

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 1:100 - 1:500 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane, Multi-pass membrane protein.

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CD47 Rabbit mAb images

Neutralization - CD47 Rabbit mAb (A24296)

Flow CytoMetry - CD47 Rabbit mAb (A24296)

Flow cytometry:1X10^6 MOLT-4 cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 2 μg/mL, left) or CD47 Rabbit mAb(A24296, 2 μg/mL, right).

* For research use only. Not for therapeutic or diagnostic purposes.