제품 > 항체 > 단일클론항체(mAb)

ABflo® 488 Rabbit anti-Human CD74 mAb (A26657)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 Jurkat cells (negative control, left) and Raji cells (right) were surface-stained with ABflo® 488 Rabbit anti-Human CD74 mAb (A26657, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 Raji cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human CD74 mAb (A26657, 5 μl/Test, right).

Flow cytometry: 1X10^6 Human PBMC were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human CD74 mAb (A26657, 5 μl/Test, right).Cells in the Lymphocytes gate were used for analysis.

Overview

Product name	ABflo® 488 Rabbit anti-Human CD74 mAb
Catalog No.	A26657
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC56788-ABflo488

Background

The protein encoded by this gene associates with class II major histocompatibility complex (MHC) and is an important chaperone that regulates antigen presentation for immune response. It also serves as cell surface receptor for the cytokine macrophage migration inhibitory factor (MIF) which, when bound to the encoded protein, initiates survival pathways and cell proliferation. This protein also interacts with amyloid precursor protein (APP) and suppresses the production of amyloid beta (Abeta). Multiple alternatively spliced transcript variants encoding different isoforms have been identified.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 73-232 of human CD74 (NP_004346.1)
Sequence	QQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKESLELEDPSSGLGVTKQDLGPVPM
Gene ID
Swiss Prot
Synonyms	II; p33; CLIP; DHLAG; HLADG; Ia-GAMMA
Calculated MW	18kDa/24kDa/26kDa/31kDa/34kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane, Endoplasmic reticulum membrane, Endosome, Golgi apparatus, Lysosome, Single-pass type II membrane protein, trans-Golgi network.

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

연구면역학 & 염증CDs

ABflo® 488 Rabbit anti-Human CD74 mAb images

Flow CytoMetry - ABflo® 488 Rabbit anti-Human CD74 mAb (A26657)

Flow cytometry: 1X10^6 Raji cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human CD74 mAb (A26657, 5 μl/Test, right).

Flow CytoMetry - ABflo® 488 Rabbit anti-Human CD74 mAb (A26657)

* For research use only. Not for therapeutic or diagnostic purposes.