제품 > 항체 > 단일클론항체(mAb)

ABflo® 488 Rabbit anti-Human CD79a mAb (A22300)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 Daudi cells were intracellularly-stained with ABflo® 488 Rabbit anti-Human CD79a mAb(A22300, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line).Non-fluorescently stained Daudi cells was used as blank control (red line).

Flow cytometry: 1X10^6 C2C12 cells(negative control) were intracellularly-stained with ABflo® 488 Rabbit anti-Human CD79a mAb(A22300, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line).Non-fluorescently stained C2C12 cells was used as blank control (red line).

Flow cytometry:1X10^6 Daudi cells were intracellularly-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human CD79a mAb(A22300, 5 μl/Test, right).

Flow cytometry:1X10^6 Human PBMC were intracellularly-stained with ABflo® 488 Rabbit anti-Human CD79a mAb(A22300, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line).Non-fluorescently stained Human PBMC was used as blank control (red line).

Flow cytometry:1X10^6 Human PBMC cells were intracellularly-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human CD79a mAb(A22300, 5 μl/Test, right).

Overview

Product name	ABflo® 488 Rabbit anti-Human CD79a mAb
Catalog No.	A22300
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC51136-ABf488

Background

The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-alpha protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 165-225 of human CD79a (NP_001774.1).
Sequence	FRKRWQNEKLGLDAGDEYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGSLNIGDVQLEK
Gene ID
Swiss Prot
Synonyms	IGA; MB1; MB-1; IGAlpha
Calculated MW	25kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC (intra) 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application
Positive samples
Cellular location	External side of plasma membrane, Multivesicular body, Plasma membrane