제품 > 항체 > 단일클론항체(mAb)

ABflo® 594 Rabbit anti-Human CD79a mAb (A24330)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry:1X10^6 Jurkat cells (negative control, left) and Daudi cells (right) were intracellularly-stained with ABflo® 594 Rabbit anti-Human CD79A mAb(A24330, 5 μl/Test, orange line) or ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 Daudi cells were intracellularly-stained with ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, left) or ABflo® 594 Rabbit anti-Human CD79A mAb(A24330, 5 μl/Test, right).

Overview

Product name	ABflo® 594 Rabbit anti-Human CD79a mAb
Catalog No.	A24330
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC51136-ABflo594

Background

The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-alpha protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 165-225 of human CD79a (NP_001774.1).
Sequence	FRKRWQNEKLGLDAGDEYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGSLNIGDVQLEK
Gene ID
Swiss Prot
Synonyms	CD79A; IGA; MB-1; CD79a molecule
Calculated MW	20kDa/25kDa
Observed MW	Refer to figures

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC (intra) 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application
Positive samples
Cellular location	Cell membrane, Single-pass type I membrane protein