제품 > 항체 > 단일클론항체(mAb)

APC Rabbit anti-Human CD79a mAb (A24200)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 Jurkat cells (Low Expression, left) and Daudi cells (right) were intracellularly-stained with APC Rabbit anti-Human CD79a mAb (A24200, 5 μl/Test, orange line) or APC Rabbit IgG isotype control (A24173, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 Daudi cells were intracellularly-stained with APC Rabbit IgG isotype control (A24173, 5 μl/Test, left) or APC Rabbit anti-Human CD79a mAb (A24200, 5 μl/Test, right).

Overview

Product name	APC Rabbit anti-Human CD79a mAb
Catalog No.	A24200
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC51136-APC

Background

The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-alpha protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 165-225 of human CD79a (NP_001774.1).
Sequence	FRKRWQNEKLGLDAGDEYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGSLNIGDVQLEK
Gene ID
Swiss Prot
Synonyms	IGA; MB1; MB-1; IGAlpha
Calculated MW	20kDa/25kDa
Observed MW	Refer to figures

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC (intra) 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application
Positive samples
Cellular location	Cell membrane, Single-pass type I membrane protein.

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

APC Rabbit anti-Human CD79a mAb images

Flow CytoMetry - APC Rabbit anti-Human CD79a mAb (A24200)

Flow cytometry: 1X10^6 Daudi cells were intracellularly-stained with APC Rabbit IgG isotype control (A24173, 5 μl/Test, left) or APC Rabbit anti-Human CD79a mAb (A24200, 5 μl/Test, right).

* For research use only. Not for therapeutic or diagnostic purposes.