제품 > 항체 > 단일클론항체(mAb)

ABflo® 488 Rabbit anti-Human CD99 mAb (A25831)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Confocal imaging of Jurkat cells using ABflo® 488 Rabbit anti-Human CD99 mAb (A25831, dilution 1:25) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Confocal imaging of MOLT-4 cells using ABflo® 488 Rabbit anti-Human CD99 mAb (A25831, dilution 1:25) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Confocal imaging of Hep G2 cells using ABflo® 488 Rabbit anti-Human CD99 mAb (A25831, dilution 1:25) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

ABclonal:Flow CytoMetry - ABflo® 488 Rabbit anti-Human CD99 mAb (A25831)

Flow cytometry: 1X10^6 U266 cells (negative control, left) and Jurkat cells (right) were surface-stained with ABflo® 488 Rabbit anti-Human CD99 mAb (A25831, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 Jurkat cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human CD99 mAb (A25831, 5 μl/Test, right).

Overview

Product name	ABflo® 488 Rabbit anti-Human CD99 mAb
Catalog No.	A25831
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC67259-ABflo488

Background

The protein encoded by this gene is a cell surface glycoprotein involved in leukocyte migration, T-cell adhesion, ganglioside GM1 and transmembrane protein transport, and T-cell death by a caspase-independent pathway. In addition, the encoded protein may have the ability to rearrange the actin cytoskeleton and may also act as an oncosuppressor in osteosarcoma. This gene is found in the pseudoautosomal region of chromosomes X and Y and escapes X-chromosome inactivation. There is a related pseudogene located immediately adjacent to this locus.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 24-123 of human CD99 (NP_002405.1).
Sequence	GGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEADA
Gene ID
Swiss Prot
Synonyms	MIC2; HBA71; MIC2X; MIC2Y; MSK5X
Calculated MW	19kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IF/ICC 1:50 - 1:200 FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Immunofluorescence Flow Cytometry
Positive samples
Cellular location	cytoplasm, focal adhesion, plasma membrane, Membrane, Single-pass type I membrane protein.

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ABflo® 488 Rabbit anti-Human CD99 mAb images

Immunofluorescence - ABflo® 488 Rabbit anti-Human CD99 mAb (A25831)

Confocal imaging of Jurkat cells using ABflo® 488 Rabbit anti-Human CD99 mAb (A25831, dilution 1:25) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Immunofluorescence - ABflo® 488 Rabbit anti-Human CD99 mAb (A25831)

Confocal imaging of MOLT-4 cells using ABflo® 488 Rabbit anti-Human CD99 mAb (A25831, dilution 1:25) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Immunofluorescence - ABflo® 488 Rabbit anti-Human CD99 mAb (A25831)

Confocal imaging of Hep G2 cells using ABflo® 488 Rabbit anti-Human CD99 mAb (A25831, dilution 1:25) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Flow CytoMetry - ABflo® 488 Rabbit anti-Human CD99 mAb (A25831)

Flow cytometry: 1X10^6 Jurkat cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human CD99 mAb (A25831, 5 μl/Test, right).

* For research use only. Not for therapeutic or diagnostic purposes.