제품 > 항체 > 단일클론항체(mAb)

CD99 Rabbit mAb (A25856)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from Hep G2 cells using CD99 Rabbit mAb (A25856) at 1:2000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunofluorescence - CD99 Rabbit mAb (A25856)

Confocal imaging of Hep G2 cells using CD99 Rabbit mAb (A25856, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Confocal imaging of MOLT-4 cells using CD99 Rabbit mAb (A25856, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.

Confocal imaging of Jurkat cells using CD99 Rabbit mAb (A25856, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.

ABclonal:Flow CytoMetry - CD99 Rabbit mAb (A25856)

Flow cytometry: 1X10^6 U266 cells (negative control, left) and Jurkat cells (right) cells were surface-stained with CD99 Rabbit mAb (A25856, 2 μg/mL, orange line) or Rabbit IgG isotype control (AC042, 2 μg/mL, blue line), followed by PE conjugated Donkey anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 Jurkat cells were surface-stained with Rabbit IgG isotype control (AC042, 2 μg/mL, left) or CD99 Rabbit mAb (A25856, 2 μg/mL, right), followed by PE conjugated Donkey anti-rabbit pAb staining.

Overview

Product name	CD99 Rabbit mAb
Catalog No.	A25856
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC67259

Background

The protein encoded by this gene is a cell surface glycoprotein involved in leukocyte migration, T-cell adhesion, ganglioside GM1 and transmembrane protein transport, and T-cell death by a caspase-independent pathway. In addition, the encoded protein may have the ability to rearrange the actin cytoskeleton and may also act as an oncosuppressor in osteosarcoma. This gene is found in the pseudoautosomal region of chromosomes X and Y and escapes X-chromosome inactivation. There is a related pseudogene located immediately adjacent to this locus.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 24-123 of human CD99 (NP_002405.1).
Sequence	GGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEADA
Gene ID
Swiss Prot
Synonyms	MIC2; HBA71; MIC2X; MIC2Y; MSK5X
Calculated MW	16-19kDa
Observed MW	32kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:2000 - 1:8000 IF/ICC 1:50 - 1:2000 FC 1:500 - 1:1000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Flow Cytometry
Positive samples	Hep G2
Cellular location	cytoplasm, focal adhesion, plasma membrane, Membrane, Single-pass type I membrane protein.