제품 > 항체 > 단일클론항체(mAb)

ABflo® 488 Rabbit anti-Human TNFRSF10D/TRAILR4 mAb (A24962)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 293F cells (Low Expression, left) and 293F (Transfection, right) cells were surface-stained with ABflo® 488 Rabbit anti-Human TNFRSF10D/TRAILR4 mAb (A24962, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 293F (Transfection) cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human TNFRSF10D/TRAILR4 mAb (A24962, 5 μl/Test, right).

Overview

Product name	ABflo® 488 Rabbit anti-Human TNFRSF10D/TRAILR4 mAb
Catalog No.	A24962
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC64404-ABflo488

Background

The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contains an extracellular TRAIL-binding domain, a transmembrane domain, and a truncated cytoplamic death domain. This receptor does not induce apoptosis, and has been shown to play an inhibitory role in TRAIL-induced cell apoptosis.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 56-211 of human TNFRSF10D/TRAILR4 (NP_003831.2).
Sequence	ATIPRQDEVPQQTVAPQQQRRSLKEEECPAGSHRSEYTGACNPCTEGVDYTIASNNLPSCLLCTVCKSGQTNKSSCTTTRDTVCQCEKGSFQDKNSPEMCRTCRTGCPRGMVKVSNCTPRSDIKCKNESAASSTGKTPAAEETVTTILGMLASPYH
Gene ID
Swiss Prot
Synonyms	DCR2; CD264; TRUNDD; TRAILR4; TRAIL-R4
Calculated MW	42kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Membrane, Single-pass type I membrane protein