제품 > 항체 > 단일클론항체(mAb)

TNFRSF10D/TRAILR4 Rabbit mAb (A24976)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 293F cells (Low Expression, left) and 293F (Transfection, right) cells were surface-stained with TNFRSF10D/TRAILR4 Rabbit mAb (A24976, 2 μg/mL, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line), followed by Alexa Fluor® 647 conjugated goat anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 293F (Transfection) cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or TNFRSF10D/TRAILR4 Rabbit mAb (A24976, 2 μg/mL, right).

Overview

Product name	TNFRSF10D/TRAILR4 Rabbit mAb
Catalog No.	A24976
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC64404

Background

The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contains an extracellular TRAIL-binding domain, a transmembrane domain, and a truncated cytoplamic death domain. This receptor does not induce apoptosis, and has been shown to play an inhibitory role in TRAIL-induced cell apoptosis.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 56-211 of human TNFRSF10D/TRAILR4 (NP_003831.2).
Sequence	ATIPRQDEVPQQTVAPQQQRRSLKEEECPAGSHRSEYTGACNPCTEGVDYTIASNNLPSCLLCTVCKSGQTNKSSCTTTRDTVCQCEKGSFQDKNSPEMCRTCRTGCPRGMVKVSNCTPRSDIKCKNESAASSTGKTPAAEETVTTILGMLASPYH
Gene ID
Swiss Prot
Synonyms	DCR2; CD264; TRUNDD; TRAILR4; TRAIL-R4; TNFRSF10D/TRAILR4
Calculated MW	42kDa
Observed MW	Refer to figures

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Membrane, Single-pass type I membrane protein

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

TNFRSF10D/TRAILR4 Rabbit mAb images

Flow CytoMetry - TNFRSF10D/TRAILR4 Rabbit mAb (A24976)

Flow cytometry: 1X10^6 293F (Transfection) cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or TNFRSF10D/TRAILR4 Rabbit mAb (A24976, 2 μg/mL, right).

* For research use only. Not for therapeutic or diagnostic purposes.