제품 > 항체 > 단일클론항체(mAb)

DCR2 Rabbit mAb (A3581)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using DCR2 Rabbit mAb (A3581) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - DCR2 Rabbit mAb (A3581)

Immunohistochemistry analysis of DCR2 in paraffin-embedded rat brain tissue using DCR2 Rabbit mAb (A3581) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of DCR2 in paraffin-embedded human thyroid cancer tissue using DCR2 Rabbit mAb (A3581) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of DCR2 in paraffin-embedded mouse kidney tissue using DCR2 Rabbit mAb (A3581) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of DCR2 in paraffin-embedded mouse brain tissue using DCR2 Rabbit mAb (A3581) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Overview

Product name	DCR2 Rabbit mAb
Catalog No.	A3581
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2052

Background

The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contains an extracellular TRAIL-binding domain, a transmembrane domain, and a truncated cytoplamic death domain. This receptor does not induce apoptosis, and has been shown to play an inhibitory role in TRAIL-induced cell apoptosis.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 287-386 of human DCR2 (Q9UBN6).
Sequence	PTQVSEQEIQGQELAELTGVTVELPEEPQRLLEQAEAEGCQRRRLLVPVNDADSADISTLLDASATLEEGHAKETIQDQLVGSEKLFYEEDEAGSATSCL
Gene ID
Swiss Prot
Synonyms	DCR2; CD264; TRUNDD; TRAILR4; TRAIL-R4
Calculated MW	42kDa
Observed MW

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	Mouse liver, Mouse kidney, Rat liver, Rat kidney
Cellular location	Cell surface, Plasma membrane