제품 > 항체 > 단일클론항체(mAb)

ABflo® 488 Rabbit anti-Mouse CD123 mAb (A26138)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Flow cytometry: 1X10^6 RAW264.7 cells (Low Expression, left) and C57BL/6 mouse bone marrow cells (right) were surface-stained with ABflo® 488 Rabbit anti-Mouse CD123 mAb (A26138, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 C57BL/6 mouse bone marrow cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Mouse CD123 mAb (A26138, 5 μl/Test, right).

Overview

Product name	ABflo® 488 Rabbit anti-Mouse CD123 mAb
Catalog No.	A26138
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC65499-ABflo488

Background

Enables interleukin-3 binding activity and interleukin-3 receptor activity. Acts upstream of or within interleukin-3-mediated signaling pathway; monocyte differentiation; and regulation of cell growth. Located in membrane. Is expressed in several structur

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 17-331 of mouse CD123 (NP_032395.1).
Sequence	SDLAAVREAPPTAVTTPIQNLHIDPAHYTLSWDPAPGADITTGAFCRKGRDIFVWADPGLARCSFQSLSLCHVTNFTVFLGKDRAVAGSIQFPPDDDGDHEAAAQDLRCWVHEGQLSCQWERGPKATGDVHYRMFWRDVRLGPAHNRECPHYHSLDVNTAGPAPHGGHEGCTLDLDTVLGSTPNSPDLVPQVTITVNGSGRAGPVPCMDNTVDLQRAEVLAPPTLTVECNGSEAHARWVARNRFHHGLLGYTLQVNQSSRSEPQEYNVSIPHFWVPNAGAISFRVKSRSEVYPRKLSSWSEAWGLVCPPEVMPVK
Gene ID
Swiss Prot
Synonyms	CD123; SUT-1; CDw123
Calculated MW	43kDa
Observed MW

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane, Endomembrane system