제품 > 항체 > 단일클론항체(mAb)

ABflo® 594 Rabbit anti-Human/Mouse CD276/B7-H3 mAb (A24590)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Flow cytometry:1X10^6 Jurkat cells (negative control, left) and PC-3 cells (right) were surface-stained with ABflo® 594 Rabbit anti-Human/Mouse CD276/B7-H3 mAb(A24590, 5 μl/Test, orange line) or ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 PC-3 cells were surface-stained with ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, left) or ABflo® 594 Rabbit anti-Human/Mouse CD276/B7-H3 mAb(A24590, 5 μl/Test, right).

Flow cytometry: 1X10^6 C2C12 cells were surface-stained with ABflo® 594 Rabbit anti-Human/Mouse CD276/B7-H3 mAb (A24590, 5 μl/Test, orange line) or ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 C2C12 cells were surface-stained with ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, left) or ABflo® 594 Rabbit anti-Human/Mouse CD276/B7-H3 mAb (A24590, 5 μl/Test, right).

Overview

Product name	ABflo® 594 Rabbit anti-Human/Mouse CD276/B7-H3 mAb
Catalog No.	A24590
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC54779-ABflo594

Background

The protein encoded by this gene belongs to the immunoglobulin superfamily, and thought to participate in the regulation of T-cell-mediated immune response. Studies show that while the transcript of this gene is ubiquitously expressed in normal tissues and solid tumors, the protein is preferentially expressed only in tumor tissues. Additionally, it was observed that the 3' UTR of this transcript contains a target site for miR29 microRNA, and there is an inverse correlation between the expression of this protein and miR29 levels, suggesting regulation of expression of this gene product by miR29. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 29-245 of human CD276/B7-H3 (NP_079516.1).
Sequence	LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFP
Gene ID
Swiss Prot
Synonyms	CD276; 4Ig-B7-H3; B7-H3; B7H3; B7RP-2; CD276 antigen
Calculated MW	33kDa/52kDa/57kDa
Observed MW

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Membrane, Single-pass type I membrane protein.