제품 > 항체 > 단일클론항체(mAb)

ABflo® 594 Rabbit anti-Human Syk mAb (A25740)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 Human PBMC were surface-stained with APC anti-human CD19 Antibody (5 μl/Test) followed by intracellular staining with ABflo® 594 Rabbit anti-Human Syk mAb (A25740, 5 μl/Test, left) or ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, right).

Overview

Product name	ABflo® 594 Rabbit anti-Human Syk mAb
Catalog No.	A25740
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC66891-ABflo594

Background

This gene encodes a member of the family of non-receptor type Tyr protein kinases. This protein is widely expressed in hematopoietic cells and is involved in coupling activated immunoreceptors to downstream signaling events that mediate diverse cellular responses, including proliferation, differentiation, and phagocytosis. It is thought to be a modulator of epithelial cell growth and a potential tumour suppressor in human breast carcinomas. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 251-350 of human Syk (NP_003168.2).
Sequence	LLRVLTVPCQKIGTQGNVNFGGRPQLPGSHPATWSAGGIISRIKSYSFPKPGHRKSSPAQGNRQESTVSFNPYEPELAPWAADKGPQREALPMDTEVYES
Gene ID
Swiss Prot
Synonyms	IMD82; p72-Syk
Calculated MW	72kDa/70kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC (intra) 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application
Positive samples
Cellular location	Cell membrane, Cytoplasm, cytosol