Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Syk Rabbit pAb |
---|---|
Catalog No. | A2123 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human Syk (NP_001128524.1). |
---|---|
Sequence | GLLRVLTVPCQKIGTQGNVNFGGRPQLPGSHPASSPAQGNRQESTVSFNPYEPELAPWAADKGPQREALPMDTEVYESPYADPEEIRPKEVYLDRKLLTLE |
Gene ID | |
Swiss Prot | |
Synonyms | IMD82; p72-Syk; Syk |
Calculated MW | 72kDa |
Observed MW | 72kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | Daudi |
Cellular location | Cell membrane, Cytoplasm, cytosol. |
Customer validation | WB(Mus musculus, Rattus norvegicus, Homo sapiens, Mus musculus) IF(Mus musculus) IHC(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A2123? Please let us know so that we can cite the reference in this datasheet.