제품 > 항체 > 단일클론항체(mAb)

ABflo® 647 Rabbit anti-Human CD50(ICAM-3) mAb (A25709)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 Daudi cells (negative control, left) and U-937 cells (right) were surface-stained with ABflo® 647 Rabbit anti-Human CD50(ICAM-3) mAb (A25709, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 U-937 cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human CD50(ICAM-3) mAb (A25709, 5 μl/Test, right).

Overview

Product name	ABflo® 647 Rabbit anti-Human CD50(ICAM-3) mAb
Catalog No.	A25709
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC67042-ABflo647

Background

The protein encoded by this gene is a member of the intercellular adhesion molecule (ICAM) family. All ICAM proteins are type I transmembrane glycoproteins, contain 2-9 immunoglobulin-like C2-type domains, and bind to the leukocyte adhesion LFA-1 protein. This protein is constitutively and abundantly expressed by all leucocytes and may be the most important ligand for LFA-1 in the initiation of the immune response. It functions not only as an adhesion molecule, but also as a potent signalling molecule. Alternative splicing results in multiple transcript variants encoding different isoforms.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 30-114 of human CD50(ICAM-3) (NP_002153.2).
Sequence	QEFLLRVEPQNPVLSAGGSLFVNCSTDCPSSEKIALETSLSKELVASGMGWAAFNLSNVTGNSRILCSVYCNGSQITGSSNITVY
Gene ID
Swiss Prot
Synonyms	CD50; CDW50; ICAM-R
Calculated MW	60kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Membrane, Single-pass type I membrane protein