제품 > 항체 > 단일클론항체(mAb)

ABflo® 647 Rabbit anti-Human IL-6R/CD126 mAb (A26724)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 HeLa cells (negative control, left) and U266 cells (right) were intracellularly-stained with ABflo® 647 Rabbit anti-Human IL-6R/CD126 mAb (A26724, 2 μg/mL, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 U266 cells were intracellularly-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human IL-6R/CD126 mAb (A26724, 5 μl/Test, right).

Flow cytometry: 1X10^6 Human PBMC were intracellularly-stained with ABflo® 647 Rabbit anti-Human IL-6R/CD126 mAb (A26724, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 Human PBMC were intracellularly-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human IL-6R/CD126 mAb (A26724, 5 μl/Test, right). Cells in the Lymphocytes gate were used for analysis.

Overview

Product name	ABflo® 647 Rabbit anti-Human IL-6R/CD126 mAb
Catalog No.	A26724
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC64301-ABflo647

Background

This gene encodes a subunit of the interleukin 6 (IL6) receptor complex. Interleukin 6 is a potent pleiotropic cytokine that regulates cell growth and differentiation and plays an important role in the immune response. The IL6 receptor is a protein complex consisting of this protein and interleukin 6 signal transducer (IL6ST/GP130/IL6-beta), a receptor subunit also shared by many other cytokines. Dysregulated production of IL6 and this receptor are implicated in the pathogenesis of many diseases, such as multiple myeloma, autoimmune diseases and prostate cancer. Alternatively spliced transcript variants encoding distinct isoforms have been identified in this gene. A pseudogene of this gene is found on chromosome 9.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 20-358 of human IL-6R/CD126 (NP_000556.1).
Sequence	LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQD
Gene ID
Swiss Prot
Synonyms	IL6Q; gp80; CD126; HIES5; IL-6R; IL6RA; IL6RQ; IL-1Ra; IL-6RA; IL6QTL; IL-6R-1
Calculated MW	52kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC (intra) 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3.
Key application
Positive samples
Cellular location	Basolateral cell membrane, Secreted, Single-pass type I membrane protein.