제품 > 항체 > 단일클론항체(mAb)

ABflo® 647 Rabbit anti-Mouse CD107b mAb (A25931)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Flow cytometry: 1X10^6 NIH/3T3-CD107b-shRNA4 cells (negative control, left) and NIH/3T3-scramble cells (right) were surface-stained with ABflo® 647 Rabbit anti-Mouse CD107b mAb (A25931, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 NIH/3T3-scramble cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Mouse CD107b mAb (A25931, 5 μl/Test, right).

Overview

Product name	ABflo® 647 Rabbit anti-Mouse CD107b mAb
Catalog No.	A25931
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC63617-ABflo647

Background

Enables protein domain specific binding activity. Involved in several processes, including autophagosome maturation; protein stabilization; and protein targeting to lysosome involved in chaperone-mediated autophagy. Acts upstream of or within muscle cell cellular homeostasis. Located in late endosome membrane; lysosomal membrane; and phagocytic vesicle membrane. Is integral component of autophagosome membrane. Is expressed in central nervous system; egg cylinder; lung; and retina. Used to study Danon disease. Human ortholog(s) of this gene implicated in Danon disease and hypertrophic cardiomyopathy. Orthologous to human LAMP2 (lysosomal associated membrane protein 2).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 26-189 of mouse CD107b (NP_001017959.1).
Sequence	LIVNLTDSKGTCLYAEWEMNFTITYETTNQTNKTITIAVPDKATHDGSSCGDDRNSAKIMIQFGFAVSWAVNFTKEASHYSIHDIVLSYNTSDSTVFPGAVAKGVHTVKNPENFKVPLDVIFKCNSVLTYNLTPVVQKYWGIHLQAFVQNGTVSKNEQVCEEDQ
Gene ID
Swiss Prot
Synonyms	Mac3; LGP-B; CD107b; Lamp-2; Lamp II; Lamp-2a; Lamp-2b; Lamp-2c
Calculated MW	46kDa
Observed MW

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Lysosome membrane, Endosome membrane, Cytoplasmic vesicle, autophagosome membrane, Cell membrane