제품 > 항체 > 다중클론항체(pAb)

CD107b Rabbit pAb (A23260)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Western blot analysis of various lysates, using CD107b Rabbit pAb (A23260) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

Overview

Product name	CD107b Rabbit pAb
Catalog No.	A23260
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables protein domain specific binding activity. Involved in several processes, including autophagosome maturation; protein stabilization; and protein targeting to lysosome involved in chaperone-mediated autophagy. Acts upstream of or within muscle cell cellular homeostasis. Located in late endosome membrane; lysosomal membrane; and phagocytic vesicle membrane. Is integral component of autophagosome membrane. Is expressed in central nervous system; egg cylinder; lung; and retina. Used to study Danon disease. Human ortholog(s) of this gene implicated in Danon disease and hypertrophic cardiomyopathy. Orthologous to human LAMP2 (lysosomal associated membrane protein 2).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 26-189 of mouse CD107b. (NP_001017959.1).
Sequence	LIVNLTDSKGTCLYAEWEMNFTITYETTNQTNKTITIAVPDKATHDGSSCGDDRNSAKIMIQFGFAVSWAVNFTKEASHYSIHDIVLSYNTSDSTVFPGAVAKGVHTVKNPENFKVPLDVIFKCNSVLTYNLTPVVQKYWGIHLQAFVQNGTVSKNEQVCEEDQ
Gene ID
Swiss Prot
Synonyms	Mac3; LGP-B; CD107b; Lamp-2; Lamp II; Lamp-2a; Lamp-2b; Lamp-2c
Calculated MW	46kDa
Observed MW	102kDa

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Mouse liver, NIH/3T3
Cellular location