제품 > 항체 > 단일클론항체(mAb)

ABflo® 647 Rabbit anti-Mouse LAMP1/CD107a mAb (A24363)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Confocal imaging of C2C12 cells using ABflo® 647 Rabbit anti-Mouse LAMP1/CD107a mAb (A24363, dilution 1:50). DAPI was used for nuclear staining (Blue). Objective: 100x.

Confocal imaging of NIH/3T3 cells using ABflo® 647 Rabbit anti-Mouse LAMP1/CD107a mAb (A24363, dilution 1:50). DAPI was used for nuclear staining (Blue). Objective: 100x.

Confocal imaging of RAW 264.7 cells using ABflo® 647 Rabbit anti-Mouse LAMP1/CD107a mAb (A24363, dilution 1:50). DAPI was used for nuclear staining (Blue). Objective: 100x.

ABclonal:Flow CytoMetry - ABflo® 647 Rabbit anti-Mouse LAMP1/CD107a mAb (A24363)

Flow cytometry:1X10^6 Raw264.7 cells were surface-stained with ABflo® 647 Rabbit anti-Mouse LAMP1/CD107a mAb(A24363, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained Raw264.7 cells were used as blank control (red line).

Flow cytometry:1X10^6 Raw264.7 cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Mouse LAMP1/CD107a mAb(A24363, 5 μl/Test, right).

Overview

Product name	ABflo® 647 Rabbit anti-Mouse LAMP1/CD107a mAb
Catalog No.	A24363
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC61633-ABflo647

Background

Enables protein domain specific binding activity. Involved in protein stabilization. Located in several cellular components, including cytoplasmic vesicle; sarcolemma; and vacuole. Is expressed in several structures, including 1-cell stage embryo; central nervous system; craniocervical region bone; extraembryonic component; and gut. Orthologous to human LAMP1 (lysosomal associated membrane protein 1).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 208-363 of mouse LAMP1/CD107a（NP_034814.2）.
Sequence	PTVSKYNVTGNNGTCLLASMALQLNITYLKKDNKTVTRAFNISPNDTSSGSCGINLVTLKVENKNRALELQFGMNASSSLFFLQGVRLNMTLPDALVPTFSISNHSLKALQATVGNSYKCNTEEHIFVSKMLSLNVFSVQVQAFKVDSDRFGSVEE
Gene ID
Swiss Prot
Synonyms	P2B; Perk; LGP-A; CD107a; Lamp-1; LGP-120
Calculated MW	43kDa
Observed MW

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IF/ICC 1:50 - 1:200 FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Immunofluorescence Flow Cytometry
Positive samples
Cellular location	Cell membrane.

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ABflo® 647 Rabbit anti-Mouse LAMP1/CD107a mAb images

Immunofluorescence - ABflo® 647 Rabbit anti-Mouse LAMP1/CD107a mAb (A24363)

Confocal imaging of C2C12 cells using ABflo® 647 Rabbit anti-Mouse LAMP1/CD107a mAb (A24363, dilution 1:50). DAPI was used for nuclear staining (Blue). Objective: 100x.

Immunofluorescence - ABflo® 647 Rabbit anti-Mouse LAMP1/CD107a mAb (A24363)

Confocal imaging of NIH/3T3 cells using ABflo® 647 Rabbit anti-Mouse LAMP1/CD107a mAb (A24363, dilution 1:50). DAPI was used for nuclear staining (Blue). Objective: 100x.

Immunofluorescence - ABflo® 647 Rabbit anti-Mouse LAMP1/CD107a mAb (A24363)

Confocal imaging of RAW 264.7 cells using ABflo® 647 Rabbit anti-Mouse LAMP1/CD107a mAb (A24363, dilution 1:50). DAPI was used for nuclear staining (Blue). Objective: 100x.

Flow CytoMetry - ABflo® 647 Rabbit anti-Mouse LAMP1/CD107a mAb (A24363)

* For research use only. Not for therapeutic or diagnostic purposes.