Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse
Product name | LAMP1/CD107a Rabbit mAb |
---|---|
Catalog No. | A23947 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC61633 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 208-363 of mouse LAMP1/CD107a(NP_034814.2). |
---|---|
Sequence | PTVSKYNVTGNNGTCLLASMALQLNITYLKKDNKTVTRAFNISPNDTSSGSCGINLVTLKVENKNRALELQFGMNASSSLFFLQGVRLNMTLPDALVPTFSISNHSLKALQATVGNSYKCNTEEHIFVSKMLSLNVFSVQVQAFKVDSDRFGSVEE |
Gene ID | |
Swiss Prot | |
Synonyms | P2B; Perk; LGP-A; CD107a; Lamp-1; LGP-120; LAMP1/CD107a |
Calculated MW | 43kDa |
Observed MW |
Reactivity | Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence Flow Cytometry |
Positive samples | C2C12, NIH/3T3 |
Cellular location | Cell membrane. |
Customer validation | WB(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A23947? Please let us know so that we can cite the reference in this datasheet.