Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse
Western blot analysis of lysates from C2C12 cells, using LAMP1/CD107a Rabbit mAb (A23947) at 1:5000 dilution. C2C12 cells were treated with PNGase F(1µL for 3h) at 37℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.
Western blot analysis of lysates from NIH/3T3 cells, using LAMP1/CD107a Rabbit mAb (A23947) at 1:5000 dilution. NIH/3T3 cells were treated with PNGase F(1µL for 3h) at 37℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.
Confocal imaging of NIH/3T3 cells using LAMP1/CD107a Rabbit mAb (A23947, dilution 1:200)(Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.
Flow cytometry: 1X10^6 RAW264.7 cells were surface-stained with LAMP1/CD107a Rabbit mAb (A23947, 2 μg/mL, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line), followed by Alexa Fluor® 647 conjugated goat anti-rabbit pAb staining. Non-fluorescently stained RAW264.7 cells were used as blank control (red line).
| Product name | LAMP1/CD107a Rabbit mAb |
|---|---|
| Catalog No. | A23947 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC61633 |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 208-363 of mouse LAMP1/CD107a（NP_034814.2）. |
|---|---|
| Sequence | PTVSKYNVTGNNGTCLLASMALQLNITYLKKDNKTVTRAFNISPNDTSSGSCGINLVTLKVENKNRALELQFGMNASSSLFFLQGVRLNMTLPDALVPTFSISNHSLKALQATVGNSYKCNTEEHIFVSKMLSLNVFSVQVQAFKVDSDRFGSVEE |
| Gene ID | |
| Swiss Prot | |
| Synonyms | P2B; Perk; LGP-A; CD107a; Lamp-1; LGP-120; LAMP1/CD107a |
| Calculated MW | 43kDa |
| Observed MW |
| Reactivity | Mouse |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunofluorescence Flow Cytometry |
| Positive samples | C2C12, NIH/3T3 |
| Cellular location | Cell membrane. |
| Customer validation | WB(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A23947? Please let us know so that we can cite the reference in this datasheet.
