제품 > 항체 > 단일클론항체(mAb)

PE Rabbit anti-Mouse LAMP1/CD107a mAb (A26061)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Flow cytometry: 1X10^6 RAW264.7 cells were surface-stained with PE Rabbit anti-Mouse LAMP1/CD107a mAb (A26061, 5 μl/Test, orange line) or PE Rabbit IgG isotype control (A24172, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 RAW264.7 cells were surface-stained with PE Rabbit IgG isotype control (A24172, 5 μl/Test, left) or PE Rabbit anti-Mouse LAMP1/CD107a mAb (A26061, 5 μl/Test, right).

Overview

Product name	PE Rabbit anti-Mouse LAMP1/CD107a mAb
Catalog No.	A26061
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC61633-PE

Background

Enables protein domain specific binding activity. Involved in protein stabilization. Located in several cellular components, including cytoplasmic vesicle; sarcolemma; and vacuole. Is expressed in several structures, including 1-cell stage embryo; central nervous system; craniocervical region bone; extraembryonic component; and gut. Orthologous to human LAMP1 (lysosomal associated membrane protein 1).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 208-363 of mouse LAMP1/CD107a（NP_034814.2）.
Sequence	PTVSKYNVTGNNGTCLLASMALQLNITYLKKDNKTVTRAFNISPNDTSSGSCGINLVTLKVENKNRALELQFGMNASSSLFFLQGVRLNMTLPDALVPTFSISNHSLKALQATVGNSYKCNTEEHIFVSKMLSLNVFSVQVQAFKVDSDRFGSVEE
Gene ID
Swiss Prot
Synonyms	P2B; Perk; LGP-A; CD107a; Lamp-1; LGP-120
Calculated MW	43kDa
Observed MW

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane.

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PE Rabbit anti-Mouse LAMP1/CD107a mAb images

Flow CytoMetry - PE Rabbit anti-Mouse LAMP1/CD107a mAb (A26061)

Flow cytometry: 1X10^6 RAW264.7 cells were surface-stained with PE Rabbit IgG isotype control (A24172, 5 μl/Test, left) or PE Rabbit anti-Mouse LAMP1/CD107a mAb (A26061, 5 μl/Test, right).

* For research use only. Not for therapeutic or diagnostic purposes.