제품 > 항체 > 다중클론항체(pAb)

ADORA2B Rabbit pAb (A1953)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Rat

Western blot analysis of various lysates, using ADORA2B Rabbit pAb (A1953) at 1:400 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 45s.

ABclonal:Immunofluorescence - ADORA2B Rabbit pAb (A1953)

Immunofluorescence analysis of C6 cells using ADORA2B Rabbit pAb (A1953) at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	ADORA2B Rabbit pAb
Catalog No.	A1953
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes an adenosine receptor that is a member of the G protein-coupled receptor superfamily. This integral membrane protein stimulates adenylate cyclase activity in the presence of adenosine. This protein also interacts with netrin-1, which is involved in axon elongation. The gene is located near the Smith-Magenis syndrome region on chromosome 17.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 100-200 of human ADORA2B (NP_000667.1).
Sequence	AVDRYLAICVPLRYKSLVTGTRARGVIAVLWVLAFGIGLTPFLGWNSKDSATNNCTEPWDGTTNESCCLVKCLFENVVPMSYMVYFNFFGCVLPPLLIMLV
Gene ID
Swiss Prot
Synonyms	ADORA2; ADORA2B
Calculated MW	36kDa
Observed MW	36kDa

Applications

Reactivity	Human, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:100 - 1:500 IF/ICC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	A-431, 293T
Cellular location	Cell membrane, Multi-pass membrane protein.
Customer validation	WB(Homo sapiens, Mus musculus) IF(Homo sapiens, Mus musculus)