Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Rat
Product name | ADORA2B Rabbit pAb |
---|---|
Catalog No. | A1953 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human ADORA2B (NP_000667.1). |
---|---|
Sequence | AVDRYLAICVPLRYKSLVTGTRARGVIAVLWVLAFGIGLTPFLGWNSKDSATNNCTEPWDGTTNESCCLVKCLFENVVPMSYMVYFNFFGCVLPPLLIMLV |
Gene ID | |
Swiss Prot | |
Synonyms | ADORA2; ADORA2B |
Calculated MW | 36kDa |
Observed MW | 36kDa |
Reactivity | Human, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | A-431, 293T |
Cellular location | Cell membrane, Multi-pass membrane protein. |
Customer validation | WB(Homo sapiens, Mus musculus) IF(Homo sapiens, Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A1953? Please let us know so that we can cite the reference in this datasheet.