Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse, Rat
Product name | VEGFR1 Rabbit mAb |
---|---|
Catalog No. | A19132 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0363 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human VEGFR1 (P17948). |
---|---|
Sequence | MVSYWDTGVLLCALLSCLLLTGSSSGSKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQAN |
Gene ID | |
Swiss Prot | |
Synonyms | FLT; FLT-1; VEGFR1; VEGFR-1; FRT |
Calculated MW | 151kDa |
Observed MW | 180kDa |
Reactivity | Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Rat heart, Rat brain, Mouse lung, Mouse brain |
Cellular location | Cell membrane, Cytoplasm, Endosome, Secreted, Single-pass type I membrane protein |
Customer validation | WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A19132? Please let us know so that we can cite the reference in this datasheet.