Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Flow cytometry: 1X10^6 HeLa cells (negative control, left) and Daudi (right) cells were surface-stained with APC Rabbit anti-Human CD185/CXCR5 mAb (A26890, 5 μl/Test, orange line) or APC Rabbit IgG isotype control (A24173, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).
Flow cytometry: 1X10^6 Daudi cells were surface-stained with APC Rabbit IgG isotype control (A24173, 5 μl/Test, left) or APC Rabbit anti-Human CD185/CXCR5 mAb (A26890, 5 μl/Test, right).
Flow cytometry: 1X10^6 Human PBMC were surface-stained with APC Rabbit IgG isotype control (A24173, 5 μl/Test, left) or APC Rabbit anti-Human CD185/CXCR5 mAb (A26890, 5 μl/Test, right).
| Product name | APC Rabbit anti-Human CD185/CXCR5 mAb |
|---|---|
| Catalog No. | A26890 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC62172-APC |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-47 of Human CD185/CXCR5 (NP_033981.2). |
|---|---|
| Sequence | MNYPLTLEMDLENLEDLFWELDRLDNYNDTSLVENHLCPATEGPLMA |
| Gene ID | |
| Swiss Prot | |
| Synonyms | BLR1; CD185; MDR15 |
| Calculated MW | 42kDa |
| Observed MW |
| Reactivity | Human |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3. |
| Key application | Flow Cytometry |
| Positive samples | |
| Cellular location | Cell membrane, Multi-pass membrane protein. |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
