제품 > 항체 > 단일클론항체(mAb)

PE Rabbit anti-Human CD185/CXCR5 mAb (A26188)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 HeLa cells (negative control, left) and Daudi cells (right) were surface-stained with PE Rabbit anti-Human CD185/CXCR5 mAb (A26188, 5 μl/Test, orange line) or PE Rabbit IgG isotype control (A24172, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 Daudi cells were surface-stained with PE Rabbit IgG isotype control (A24172, 5 μl/Test, left) or PE Rabbit anti-Human CD185/CXCR5 mAb (A26188, 5 μl/Test, right).

Flow cytometry: 1X10^6 Human PBMC were surface-stained with PE Rabbit IgG isotype control (A24172, 5 μl/Test, left) or PE Rabbit anti-Human CD185/CXCR5 mAb (A26188, 5 μl/Test, right).

Flow cytometry:1X10^6 Human PBMC were surface-stained with ABflo® 647 Mouse anti-Human CD19 mAb (5 μl/Test) and PE Rabbit IgG isotype control (A24172, 5 μl/Test, left) or PE Rabbit anti-Human CD185/CXCR5 mAb (A26188, 5 μl/Test, right). Cells in the lymphocyte gate were used for analysis.

Overview

Product name	PE Rabbit anti-Human CD185/CXCR5 mAb
Catalog No.	A26188
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC62172-PE

Background

This gene encodes a multi-pass membrane protein that belongs to the CXC chemokine receptor family. It is expressed in mature B-cells and Burkitt's lymphoma. This cytokine receptor binds to B-lymphocyte chemoattractant (BLC), and is involved in B-cell migration into B-cell follicles of spleen and Peyer patches. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-47aa of human CD185/CXCR5 (NP_033981.2).
Sequence	MNYPLTLEMDLENLEDLFWELDRLDNYNDTSLVENHLCPATEGPLMA
Gene ID
Swiss Prot
Synonyms	BLR1; CD185; MDR15
Calculated MW	36kDa/42kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane, Multi-pass membrane protein.

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PE Rabbit anti-Human CD185/CXCR5 mAb images

Flow CytoMetry - PE Rabbit anti-Human CD185/CXCR5 mAb (A26188)

Flow cytometry: 1X10^6 Daudi cells were surface-stained with PE Rabbit IgG isotype control (A24172, 5 μl/Test, left) or PE Rabbit anti-Human CD185/CXCR5 mAb (A26188, 5 μl/Test, right).

Flow CytoMetry - PE Rabbit anti-Human CD185/CXCR5 mAb (A26188)

Flow cytometry: 1X10^6 Human PBMC were surface-stained with PE Rabbit IgG isotype control (A24172, 5 μl/Test, left) or PE Rabbit anti-Human CD185/CXCR5 mAb (A26188, 5 μl/Test, right).

Flow CytoMetry - PE Rabbit anti-Human CD185/CXCR5 mAb (A26188)

* For research use only. Not for therapeutic or diagnostic purposes.