Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Western blot analysis of various lysates, using CXCR5/CD185 Rabbit mAb (A23989) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC): HeLa
Exposure time: 5s.
Flow cytometry: 1X10^6 HeLa cells (negative control, left) and Daudi cells (right) were surface-stained with CXCR5/CD185 Rabbit mAb (A23989, 2 μg/mL, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line), followed by FITC conjugated goat anti-Rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).
| Product name | CXCR5/CD185 Rabbit mAb |
|---|---|
| Catalog No. | A23989 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC62169 |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-47 of human CXCR5 (NP_001707.1) |
|---|---|
| Sequence | MNYPLTLEMDLENLEDLFWELDRLDNYNDTSLVENHLCPATEGPLMA |
| Gene ID | |
| Swiss Prot | |
| Synonyms | BLR1; CD185; MDR15; CXCR5/CD185 |
| Calculated MW | 42kDa |
| Observed MW | 42kDa |
| Reactivity | Human, Mouse |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Flow Cytometry |
| Positive samples | Daudi, Raji |
| Cellular location | Cell membrane, Multi-pass membrane protein. |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
