제품 > 항체 > 단일클론항체(mAb)

APC Rabbit anti-Human CD261/TRAIL-R1 mAb (A26511)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 BeWo cells (negative control, left) and HeLa cells (right) were surface-stained with APC Rabbit anti-Human CD261/TRAIL-R1 mAb (A26511, 5 μl/Test, orange line) or APC Rabbit IgG isotype control (A24173, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 HeLa cells were surface-stained with APC Rabbit IgG isotype control (A24173, 5 μl/Test, left) or APC Rabbit anti-Human CD261/TRAIL-R1 mAb (A26511, 5 μl/Test, right).

Overview

Product name	APC Rabbit anti-Human CD261/TRAIL-R1 mAb
Catalog No.	A26511
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC63581-APC

Background

The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is activated by tumor necrosis factor-related apoptosis inducing ligand (TNFSF10/TRAIL), and thus transduces cell death signal and induces cell apoptosis. Studies with FADD-deficient mice suggested that FADD, a death domain containing adaptor protein, is required for the apoptosis mediated by this protein.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 124-232 of human CD261/TRAIL-R1 (NP_003835.3).
Sequence	EHSPLGELCPPGSHRSEHPGACNRCTEGVGYTNASNNLFACLPCTACKSDEEERSPCTTTRNTACQCKPGTFRNDNSAEMCRKCSRGCPRGMVKVKDCTPWSDIECVHK
Gene ID
Swiss Prot
Synonyms	TNFRSF10A; APO2; CD261; DR4; TRAILR-1; TRAILR1; TNF receptor superfamily member 10a
Calculated MW	50kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Membrane, single-pass type I membrane protein.

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

APC Rabbit anti-Human CD261/TRAIL-R1 mAb images

Flow CytoMetry - APC Rabbit anti-Human CD261/TRAIL-R1 mAb (A26511)

Flow cytometry: 1X10^6 HeLa cells were surface-stained with APC Rabbit IgG isotype control (A24173, 5 μl/Test, left) or APC Rabbit anti-Human CD261/TRAIL-R1 mAb (A26511, 5 μl/Test, right).

* For research use only. Not for therapeutic or diagnostic purposes.