제품 > 항체 > 다중클론항체(pAb)

TNFRSF10A Rabbit pAb (A12540)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using TNFRSF10A antibody (A12540) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunofluorescence - TNFRSF10A Rabbit pAb (A12540)

Immunofluorescence analysis of THP-1 cells using TNFRSF10A Polyclonal Antibody (A12540) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of rat spleen using TNFRSF10A Polyclonal Antibody (A12540) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Review

Overview

Product name	TNFRSF10A Rabbit pAb
Catalog No.	A12540
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is activated by tumor necrosis factor-related apoptosis inducing ligand (TNFSF10/TRAIL), and thus transduces cell death signal and induces cell apoptosis. Studies with FADD-deficient mice suggested that FADD, a death domain containing adaptor protein, is required for the apoptosis mediated by this protein.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 269-468 of human TNFRSF10A (NP_003835.3).
Sequence	GGDPKCMDRVCFWRLGLLRGPGAEDNAHNEILSNADSLSTFVSEQQMESQEPADLTGVTVQSPGEAQCLLGPAEAEGSQRRRLLVPANGADPTETLMLFFDKFANIVPFDSWDQLMRQLDLTKNEIDVVRAGTAGPGDALYAMLMKWVNKTGRNASIHTLLDALERMEERHAREKIQDLLVDSGKFIYLEDGTGSAVSLE
Gene ID
Swiss Prot
Synonyms	DR4; APO2; CD261; TRAILR1; TRAILR-1
Calculated MW	50kDa
Observed MW	40-55kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:100
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	K-562, SW480, MCF7, HeLa, DU145, Mouse lung, Rat lung
Cellular location	Membrane, Single-pass type I membrane protein
Customer validation	(Human fibrosarcoma cells, Human colon cancer cell) WB(Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

TNFRSF10A Rabbit pAb images

Western blot - TNFRSF10A Rabbit pAb (A12540)

Immunofluorescence - TNFRSF10A Rabbit pAb (A12540)

Immunofluorescence analysis of THP-1 cells using TNFRSF10A Polyclonal Antibody (A12540) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence - TNFRSF10A Rabbit pAb (A12540)

Immunofluorescence analysis of rat spleen using TNFRSF10A Polyclonal Antibody (A12540) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

* For research use only. Not for therapeutic or diagnostic purposes.