제품 > 항체 > 단일클론항체(mAb)

DR4 Rabbit mAb (A24703)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 BEWO cells (negative control, left) and HeLa cells (right) were surface-stained with DR4 Rabbit mAb (A24703, 2 μg/mL, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 2 μg/mL, blue line), followed by Alexa Fluor® 647 conjugated goat anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 HeLa cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 2 μg/mL, left) or DR4 Rabbit mAb (A24703, 2 μg/mL, right).

Overview

Product name	DR4 Rabbit mAb
Catalog No.	A24703
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC63581

Background

The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is activated by tumor necrosis factor-related apoptosis inducing ligand (TNFSF10/TRAIL), and thus transduces cell death signal and induces cell apoptosis. Studies with FADD-deficient mice suggested that FADD, a death domain containing adaptor protein, is required for the apoptosis mediated by this protein.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 124-232 of human DR4 (NP_003835.3).
Sequence	EHSPLGELCPPGSHRSEHPGACNRCTEGVGYTNASNNLFACLPCTACKSDEEERSPCTTTRNTACQCKPGTFRNDNSAEMCRKCSRGCPRGMVKVKDCTPWSDIECVHK
Gene ID
Swiss Prot
Synonyms	TNFRSF10A; APO2; CD261; DR4; TRAILR-1; TRAILR1; TNF receptor superfamily member 10a
Calculated MW	50kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 1:100 - 1:500
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Membrane, single-pass type I membrane protein.

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

DR4 Rabbit mAb images

Flow CytoMetry - DR4 Rabbit mAb (A24703)

Flow cytometry: 1X10^6 HeLa cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 2 μg/mL, left) or DR4 Rabbit mAb (A24703, 2 μg/mL, right).

* For research use only. Not for therapeutic or diagnostic purposes.