제품 > 항체 > 단일클론항체(mAb)

APC Rabbit anti-Human CD44 mAb (A24106)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 Jurkat cells (negative control, left) and HeLa cells (right) were surface-stained with APC Rabbit anti-Human CD44 mAb (A24106, 5 μl/Test, orange line) or APC Rabbit IgG isotype control (5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 HeLa cells were surface-stained with APC Rabbit IgG isotype control (5 μl/Test, left) or APC Rabbit anti-Human CD44 mAb (A24106, 5 μl/Test, right).

Overview

Product name	APC Rabbit anti-Human CD44 mAb
Catalog No.	A24106
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC52412-APC

Background

The protein encoded by this gene is a cell-surface glycoprotein involved in cell-cell interactions, cell adhesion and migration. It is a receptor for hyaluronic acid (HA) and can also interact with other ligands, such as osteopontin, collagens, and matrix metalloproteinases (MMPs). This protein participates in a wide variety of cellular functions including lymphocyte activation, recirculation and homing, hematopoiesis, and tumor metastasis. Transcripts for this gene undergo complex alternative splicing that results in many functionally distinct isoforms, however, the full length nature of some of these variants has not been determined. Alternative splicing is the basis for the structural and functional diversity of this protein, and may be related to tumor metastasis.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 20-178 of human CD44 (NP_000601.3).
Sequence	AQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDV
Gene ID
Swiss Prot
Synonyms	IN; LHR; MC56; MDU2; MDU3; MIC4; Pgp1; CDW44; CSPG8; H-CAM; HCELL; ECM-III; HUTCH-1; HUTCH-I; ECMR-III; Hermes-1
Calculated MW	82kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane, Single-pass type I membrane protein, Cell projection, Microvillus, Secreted.

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

APC Rabbit anti-Human CD44 mAb images

Flow CytoMetry - APC Rabbit anti-Human CD44 mAb (A24106)

Flow cytometry: 1X10^6 HeLa cells were surface-stained with APC Rabbit IgG isotype control (5 μl/Test, left) or APC Rabbit anti-Human CD44 mAb (A24106, 5 μl/Test, right).

* For research use only. Not for therapeutic or diagnostic purposes.