제품 > 항체 > 단일클론항체(mAb)

PE Rabbit anti-Human CD44V6 mAb (A26928)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 293T cells (negative control, left) and 293T (Transfection, right) cells were surface-stained with PE Rabbit anti-Human CD44V6 mAb (A26928, 5 μl/Test, orange line) or PE Rabbit IgG isotype control (A24172, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 293T (Transfection) cells were surface-stained with PE Rabbit IgG isotype control (A24172, 5 μl/Test, left) or PE Rabbit anti-Human CD44V6 mAb (A26928, 5 μl/Test, right).

Overview

Product name	PE Rabbit anti-Human CD44V6 mAb
Catalog No.	A26928
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC69840-PE

Background

The protein encoded by this gene is a cell-surface glycoprotein involved in cell-cell interactions, cell adhesion and migration. It is a receptor for hyaluronic acid (HA) and can also interact with other ligands, such as osteopontin, collagens, and matrix metalloproteinases (MMPs). This protein participates in a wide variety of cellular functions including lymphocyte activation, recirculation and homing, hematopoiesis, and tumor metastasis. Transcripts for this gene undergo complex alternative splicing that results in many functionally distinct isoforms, however, the full length nature of some of these variants has not been determined. Alternative splicing is the basis for the structural and functional diversity of this protein, and may be related to tumor metastasis.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 223-267 of human CD44V6 (P16070).
Sequence	TLMSTSATATETATKRQETWDWFSWLFLPSESKNHLHTTTQMAGT
Gene ID
Swiss Prot
Synonyms	IN; LHR; MC56; MDU2; MDU3; MIC4; Pgp1; CDW44; CSPG8; H-CAM; HCELL; ECM-III; HUTCH-1; HUTCH-I; ECMR-III; Hermes-1
Calculated MW	82kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane, Single-pass type I membrane protein, Cell projection, Microvillus, Secreted, apical plasma membrane, basolateral plasma membrane, cell projection, cell surface, cytosol, extracellular exosome, focal adhesion, Golgi apparatus, lamellipodium membrane, plasma membrane.

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PE Rabbit anti-Human CD44V6 mAb images

Flow CytoMetry - PE Rabbit anti-Human CD44V6 mAb (A26928)

Flow cytometry: 1X10^6 293T (Transfection) cells were surface-stained with PE Rabbit IgG isotype control (A24172, 5 μl/Test, left) or PE Rabbit anti-Human CD44V6 mAb (A26928, 5 μl/Test, right).

* For research use only. Not for therapeutic or diagnostic purposes.